PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01240.1.g00220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 299aa    MW: 31118.4 Da    PI: 5.417
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01240.1.g00220.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.21e-091664245
                                    SSS-HHHHHHHHHHHHHTTTT......-HHHHHHHHTTTS-HHHHHHHHH CS
                 Myb_DNA-binding  2 grWTteEdellvdavkqlGgg......tWktIartmgkgRtlkqcksrwq 45
                                    g+WT e ++ + +av+    +      +W++Ia+ +  g+t+++++ ++ 
  Zmw_sc01240.1.g00220.1.sm.mkhc 16 GAWTREQEKAFENAVATVAEDdqegdaRWEKIAELVE-GKTAEEIRRHYE 64
                                    79*****************99****************.**********95 PP

2Myb_DNA-binding39.81e-12127171347
                                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                 Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                     +WT++E+ l++ + +++G+g+W++I+r +   Rt+ q+ s+ qky
  Zmw_sc01240.1.g00220.1.sm.mkhc 127 AWTEDEHRLFLLGLEKYGKGDWRSISRNFVISRTPTQVASHAQKY 171
                                     6*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.9211371IPR017884SANT domain
SMARTSM007175.7E-71469IPR001005SANT/Myb domain
PfamPF002496.6E-81664IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-51664IPR009057Homeodomain-like
CDDcd001672.54E-81767No hitNo description
SuperFamilySSF466898.61E-101873IPR009057Homeodomain-like
PROSITE profilePS5129416.605120176IPR017930Myb domain
SuperFamilySSF466892.02E-16122177IPR009057Homeodomain-like
SMARTSM007179.3E-11124174IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.7E-17124174IPR006447Myb domain, plants
CDDcd001673.17E-10127172No hitNo description
PfamPF002493.4E-11127171IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-11127170IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MAVEEAIASS SEEGAGAWTR EQEKAFENAV ATVAEDDQEG DARWEKIAEL VEGKTAEEIR  60
RHYELLVEDV DGIEAGRVPL PTYAGEAGAD EGGGGGGSGK KGSGGGGGSG EKGSAKSAEQ  120
ERRKGIAWTE DEHRLFLLGL EKYGKGDWRS ISRNFVISRT PTQVASHAQK YFIRLNSMNR  180
ERRRSSIHDI TSVNNGDASA AQGPITGTNG QAANPGKSTK QTPQLANTPP GVDTYGTTIG  240
QPVGGPLVSA VGTPVTLPVP APPHMAYGIH APVAGAVVPG APVNIAPMPY PMPPPPSHG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A8e-151083273RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448771.11e-156hypothetical protein SORBIDRAFT_06g032880
SwissprotQ8S9H76e-61DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0A9DCA71e-159A0A0A9DCA7_ARUDO; Uncharacterized protein
STRINGSb06g032880.11e-156(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63763854